Recombinant Mouse Complement receptor type 2 (Cr2), partial

• Description :

  Recombinant Mouse Complement receptor type 2 (Cr2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Complement receptor type 2 (Cr2) . Accession Number: P19070; Cr2. Expression Region: 12-145aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 18.7kda. Target Synonyms: Complement C3d receptor CD_antigen: CD21 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description :

  Recombinant Mouse Complement receptor type 2 (Cr2), partial is a purified Recombinant Protein.

• Accession Number :

  P19070; Cr2

• Expression Region :

  12-145aa

• Host :

  E. coli

• Target :

  Complement receptor type 2 (Cr2)

• Conjugation :

  Unconjugated

• Tag :

  N-Terminal 6xHis-Tagged

• Field of Research :

  Immunology

• Endotoxin :

  Not Tested

• Purity :

  >90% by SDS-PAGE

• Activity :

  Not Tested

• Length :

  Partial

• Reconstitution :

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight :

  18.7kDa

• Shipping Conditions :

  Ice packs

• Storage Conditions :

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name :

  Complement C3d receptor CD_antigen: CD21

• Species :

  Mouse (Mus musculus)

• Protein Name :

  Recombinant Protein

• AA Sequence :

  ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE