Recombinant Human Complement receptor type 1 (CR1), partial

• Description :

  Recombinant Human Complement receptor type 1 (CR1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Complement receptor type 1 (CR1) . Accession Number: P17927; CR1. Expression Region: 41-234aa. Tag Info: Tag-Free. Theoretical MW: 21.6kda. Target Synonyms: C3b/C4b receptor; CD antigen CD35 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description :

  Recombinant Human Complement receptor type 1 (CR1), partial is a purified Recombinant Protein.

• Accession Number :

  P17927; CR1

• Expression Region :

  41-234aa

• Host :

  E. coli

• Target :

  Complement receptor type 1 (CR1)

• Conjugation :

  Unconjugated

• Tag :

  Tag-Free

• Field of Research :

  Others

• Endotoxin :

  Not Tested

• Purity :

  >85% by SDS-PAGE

• Activity :

  Not Tested

• Length :

  Partial

• Reconstitution :

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight :

  21.6kDa

• Shipping Conditions :

  Ice packs

• Storage Conditions :

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name :

  C3b/C4b receptor; CD antigen CD35

• Species :

  Human (Homo sapiens)

• Protein Name :

  Recombinant Protein

• AA Sequence :

  GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII