Recombinant Mouse Apolipoprotein E (Apoe)

• Description:

  Recombinant Mouse Apolipoprotein E (Apoe) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Apolipoprotein E (Apoe) . Accession Number: P08226; Apoe. Expression Region: 19-311aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 35.4kda. Target Synonyms: Apolipoprotein E (Apo-E) Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description:

  Recombinant Mouse Apolipoprotein E (Apoe) is a purified Recombinant Protein.

• Accession Number:

  P08226; Apoe

• Expression Region:

  19-311aa

• Host:

  E. coli

• Target:

  Apolipoprotein E (Apoe)

• Conjugation:

  Unconjugated

• Tag:

  C-Terminal 6xHis-Tagged

• Field of Research:

  Others

• Endotoxin:

  Not Tested

• Purity:

  >90% by SDS-PAGE

• Activity:

  Not Tested

• Length:

  Full Length of Mature Protein

• Reconstitution:

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight:

  35.4kDa

• Shipping Conditions:

  Ice packs

• Storage Conditions:

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name:

  Apolipoprotein E (Apo-E)

• Species:

  Mouse (Mus musculus)

• Protein Name:

  Recombinant Protein

• AA Sequence:

  EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ