Recombinant Mouse Apolipoprotein E (Apoe)

• Description :

  Recombinant Mouse Apolipoprotein E (Apoe) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Apolipoprotein E (Apoe) . Accession Number: P08226; Apoe. Expression Region: 19-311aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 35.4kda. Target Synonyms: Apolipoprotein E (Apo-E) Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description :

  Recombinant Mouse Apolipoprotein E (Apoe) is a purified Recombinant Protein.

• Accession Number :

  P08226; Apoe

• Expression Region :

  19-311aa

• Host :

  E. coli

• Target :

  Apolipoprotein E (Apoe)

• Conjugation :

  Unconjugated

• Tag :

  C-Terminal 6xHis-Tagged

• Field of Research :

  Others

• Endotoxin :

  Not Tested

• Purity :

  >90% by SDS-PAGE

• Activity :

  Not Tested

• Length :

  Full Length of Mature Protein

• Reconstitution :

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight :

  35.4kDa

• Shipping Conditions :

  Ice packs

• Storage Conditions :

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name :

  Apolipoprotein E (Apo-E)

• Species :

  Mouse (Mus musculus)

• Protein Name :

  Recombinant Protein

• AA Sequence :

  EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ