TGFB2 Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


TGFB2 Human
Description :
TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.Swiss Prot :
P61812Source :
Nicotiana benthamiana.Buffer :
Lyophilized from a concentrated (1 mg/mL) solution containing 50mM Tris-HCl pH-7.4.Storage Conditions :
Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TGFB2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) . Please prevent freeze-thaw cycles.Sequence Similarities :
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIH

