TGFB2 Human

CAT:
1071-OM301483-01
Size:
1 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
TGFB2 Human - image 1

TGFB2 Human

  • Description :

    TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.
  • Swiss Prot :

    P61812
  • Source :

    Nicotiana benthamiana.
  • Buffer :

    Lyophilized from a concentrated (1 mg/mL) solution containing 50mM Tris-HCl pH-7.4.
  • Storage Conditions :

    Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TGFB2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) . Please prevent freeze-thaw cycles.
  • Sequence Similarities :

    ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIH

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide