TGFB2 Human

CAT: 1071-OM301483-01Size: 1 µgDry Ice: NoHazardous: No

CAT#:1071-OM301483-01Size:1 µg

Selected

PRICE

AVAILABILITY: InStock

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

1 / 1

Description

TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.

Swiss Prot

P61812

Source

Nicotiana benthamiana.

Buffer

Lyophilized from a concentrated (1 mg/mL) solution containing 50mM Tris-HCl pH-7.4.

Storage Conditions

Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TGFB2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) . Please prevent freeze-thaw cycles.

Sequence Similarities

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIH

Related Products

Catalog	Name
OM299064-01	TGFBR2 Human
OM306353-01	TGFBI Human
OM306347-01	TGFBI Human, 182 a.a.
OM299060-01	TGFBR2 Human, His
OM301469-01	TGFB3 (24-412 a.a.) Human
P0240	Human, Rat, Mouse TGFB3 antibody
OM770019-01	Eukaryotic Transforming Growth Factor Beta 1 (TGFb1) (Human)
OM301479-01	TGFB1 Mouse
OM302864-01	IF Human
OM300153-01	IYD Human

Alternative Products

Catalog	Name
HY-174533	Human TGFB2 mRNA
46592051	TGFB2 Adenovirus (Human)
P518705	TGFB2 Protein (Human)
MBS8212912-01	TGFB2 siRNA (Human)
abx905546-01	Human TGFB2 siRNA
GR104193	Genorise® Recombinant human TGFb2
MBS8428477-01	Human TGFB2 Protein Lysate
CD00830-01	Recombinant Human TGFB2 protein
abx954815-01	Human TGFB2 shRNA Plasmid
OKEH00308-96W	TGFB2 ELISA Kit (Human)

TGFB2 Human

Related Products

Alternative Products

Popular Products