LR3 IGF1 Human

CAT:
1071-OM301241-01
Size:
200 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
LR3 IGF1 Human - image 1

LR3 IGF1 Human

  • Description :

    The LR3 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals.
  • Source :

    Escherichia Coli.
  • Buffer :

    Lyophilized from a 0.2µm filtered concentrated solution in 1xPBS.
  • Storage Conditions :

    Lyophilized LR3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution the LR3 IGF1 should be stored at 4°C between 2-7 days and for future use below -18°C.
  • Sequence Similarities :

    MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA.

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide