Products for Research Use Only

Chitodextrinase

CAT: 1071-OM300185-02Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:1071-OM300185-02Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Chitodextrinase Clostridium Botulinum Recombinant fused with a 13 amino acid His tag at N-terminus produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 590 amino acids and having a molecular mass of 66.9kDa. The Chitodextrinase is purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Buffer
Chitodextrinase lyophilized from a 0.2µm filtered concentrated solution in PBS.
Storage Conditions
Lyophilized Chitodextrinase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Chitodextrinase should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
HMRGSGSHHHHHHKEKFKTTKIKNSSELNRKLVGYFPEWAYSSEAQGYFNVTD

Popular Products