PON1 Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


PON1 Human
Description :
Paraoxonase-1 Isoform Human Recombinant is expressed in E. coli having a molecular weight of 42.9 kDa and fused to a 4.5kDa amino terminal hexahistidine tag.Swiss Prot :
P27169Source :
Escherichia Coli.Buffer :
PON1 is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.Sequence Similarities :
MAKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIE

