OTOR Human

• Description:

  Otoraplin Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 111 amino acids and having a molecular mass of 12.7 kDa.

• Swiss Prot:

  Q9NRC9

• Source:

  Escherichia Coli.

• Buffer:

  The OTOR protein was lyophilized from a concentrated (1 mg/mL) solution containing 20mM PBS pH-7.4 and 130mM NaCl.

• Storage Conditions:

  Lyophilized OTOR Recombinant although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution OTOR should be stored at 4°C between 2-7 days and for future use below -18°C.

• Sequence Similarities:

  VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYS