OTOR Human

CAT:
1071-OM297378-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
OTOR Human - image 1

OTOR Human

  • Description :

    Otoraplin Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 111 amino acids and having a molecular mass of 12.7 kDa.
  • Swiss Prot :

    Q9NRC9
  • Source :

    Escherichia Coli.
  • Buffer :

    The OTOR protein was lyophilized from a concentrated (1 mg/mL) solution containing 20mM PBS pH-7.4 and 130mM NaCl.
  • Storage Conditions :

    Lyophilized OTOR Recombinant although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution OTOR should be stored at 4°C between 2-7 days and for future use below -18°C.
  • Sequence Similarities :

    VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYS

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide