Products for Research Use Only
RegisterLogin

BNP Human

CAT: 1071-OM297056-01Size: 10 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:1071-OM297056-01Size:10 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C
Swiss Prot
P16860
Buffer
The protein was lyophilized without additives.
Storage Conditions
Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.

Related Products

CatalogName
OM297060-01BNP (27-102) Human
OM624372Bovine B-Type Natriuretic Peptide (BNP) ELISA Kit
OM302864-01IF Human
OM619873Bovine Beta-Naphthol (BNPH) ELISA Kit
OM305547-01POP7 Human
OM306569-01RALA Human
OM306563-01ZCCHC12 Human
OM306531-01RCHY1 Human
OM306525-01ZNHIT1 Human
OM306513-01ULBP1 Human

Alternative Products

CatalogName
P83251PMG36e-ADH1B (human-opt-human) -ALDH2 (human-opt-human)
P81559PCMV-Twinstrep-UFM1 (human) -UFM1 (human-opt-human) -UFM1 (human-opt-human) -Neo
9230-10Human CellExp™ Human CD40/ TNFRSF5, Human recombinant
P1493-200Human CellExp™ Human Serum Albumin, Human Recombinant
PT_75080-01Adiponectin Human (Acrp30 Human)
PT_42362-01Urokinase Human (Urokinase Human)
PT_42243-01Human Thrombin (Thrombin Human)
PT_41408-01Leuprolide Human (Leuprorelin Human)
PT_41403-01Human Leptin (Leptin Human)
PT_40803-01Haptoglobin Human (Haptoglobin Human)

Popular Products