IL 1 beta Rat

• Description:

  Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa.

• Swiss Prot:

  Q63264

• Source:

  Escherichia Coli.

• Buffer:

  The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4.

• Storage Conditions:

  Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C.

• Sequence Similarities:

  MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSF