IL 1 beta Rat
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No








IL 1 beta Rat
Description :
Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa.Swiss Prot :
Q63264Source :
Escherichia Coli.Buffer :
The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4.Storage Conditions :
Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C.Sequence Similarities :
MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSF
