IL 1 beta Rat

CAT:
1071-OM296778-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
IL 1 beta Rat - image 1
IL 1 beta Rat - image 2
Thumbnail 1
Thumbnail 2

IL 1 beta Rat

  • Description :

    Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa.
  • Swiss Prot :

    Q63264
  • Source :

    Escherichia Coli.
  • Buffer :

    The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4.
  • Storage Conditions :

    Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C.
  • Sequence Similarities :

    MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSF

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide