IL 19 Mouse

• Description:

  Interleukin-19 Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17.7kDa.

• Swiss Prot:

  Q8CJ70

• Source:

  Escherichia Coli.

• Buffer:

  Lyophilized from a sterile filtered aqueous solution containing 5mM Na

• Storage Conditions:

  Lyophilized Interleukin-19 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL19 should be stored at 4°C between 2-7 days and for future use below -18°C.

• Sequence Similarities:

  MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLL