IL 19 Mouse

CAT:
1071-OM296670-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
IL 19 Mouse - image 1
IL 19 Mouse - image 2
Thumbnail 1
Thumbnail 2

IL 19 Mouse

  • Description :

    Interleukin-19 Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17.7kDa.
  • Swiss Prot :

    Q8CJ70
  • Source :

    Escherichia Coli.
  • Buffer :

    Lyophilized from a sterile filtered aqueous solution containing 5mM Na
  • Storage Conditions :

    Lyophilized Interleukin-19 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL19 should be stored at 4°C between 2-7 days and for future use below -18°C.
  • Sequence Similarities :

    MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLL

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide