β-Amyloid (1-42), (rat/mouse) (TFA)
CAT:
804-HY-P1388A-02
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
β-Amyloid (1-42), (rat/mouse) (TFA)
- UNSPSC Description: β-Amyloid (1-42), (rat/mouse) TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.
- Target Antigen: Amyloid-β
- Type: Peptides
- Related Pathways: Neuronal Signaling
- Applications: Neuroscience-Neurodegeneration
- Field of Research: Neurological Disease
- Assay Protocol: https://www.medchemexpress.com/_beta_-Amyloid__1-42_,_rat_TFA.html
- Purity: 99.26
- Solubility: DMSO : 55 mg/mL (ultrasonic)
- Smiles: [DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA (TFA salt)]
- Molecular Weight: 4418.02 (free acid)
- References & Citations: [1]Mozes E, et al. A novel method for the rapid determination of beta-amyloid toxicity on acute hippocampal slices using MTT and LDH assays. Brain Res Bull. 2012 Apr 10;87(6):521-5.|[2]Lagunes T, et al. Abeta(1-42) induces abnormal alternative splicing of tau exons 2/3 in NGF-induced PC12 cells. An Acad Bras Cienc. 2014 Dec;86(4):1927-34.|[3]Stefania Sabella, et al. Capillary electrophoresis studies on the aggregation process of beta-amyloid 1-42 and 1-40 peptides. Electrophoresis. 2004 Oct;25(18-19):3186-94.|[4]Chennakesavan Karthick, et al. Time-dependent effect of oligomeric amyloid-β (1-42)-induced hippocampal neurodegeneration in rat model of Alzheimer's disease. Neurol Res. 2019 Feb;41(2):139-150.
- Shipping Conditions: Blue Ice
- Storage Conditions: -80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)
- Clinical Information: No Development Reported