CLOCK Antibody

CAT:
800-R31811
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
CLOCK Antibody - image 1

CLOCK Antibody

  • Description :

    CLOCK (Circadian Locomotor Output Cycles Kaput) is also known as KAT13D. The protein encoded by this gene plays a central role in the regulation of circadian rhythms. This protein encodes a transcription factor of the basic helix-loop-helix (bHLH) family and contains DNA binding histone acetyltransferase activity. And the encoded protein forms a heterodimer with ARNTL (BMAL1) that binds E-box enhancer elements upstream of Period (PER1, PER2, PER3) and Cryptochrome (CRY1, CRY2) genes and activates transcription of these genes. PER and CRY proteins heterodimerize and repress their own transcription by interacting in a feedback loop with CLOCK/ARNTL complexes. Polymorphisms in this gene may be associated with behavioral changes in certain populations and with obesity and metabolic syndrome. Alternative splicing results in multiple transcript variants.
  • Specifications :

    Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 2-5 µg/mL, Immunofluorescence: 5 µg/mL, Flow cytometry: 1-3ug/million cells
  • UniProt :

    O15516
  • Host :

    Rabbit
  • Reactivity :

    Human, Mouse, Rat, Monkey
  • Immunogen :

    Amino acids QKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEE of human CLOCK were used as the immunogen for the CLOCK antibody.
  • Clonality :

    Polyclonal
  • Isotype :

    IgG
  • Applications :

    WB, IHC-P, IF, FACS
  • Purity :

    Antigen affinity
  • Format :

    Antigen affinity purified
  • Buffer :

    Lyophilized from 1X PBS with 2% Trehalose
  • Limitations :

    This CLOCK antibody is available for research use only.
  • Storage Conditions :

    After reconstitution, the CLOCK antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation :

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes :

    Optimal dilution of the CLOCK antibody should be determined by the researcher.
  • Location :

    Nuclear, cytoplasmic
  • Image Legend :

    Immunofluorescent staining of FFPE human U-2 OS cells with CLOCK antibody (green) and Alpha Tubulin mAb (red) . HIER: steam section in pH6 citrate buffer for 20 min.

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide