Recombinant Mycoplasma pneumoniae Protein P200 (p200) , partial

Recombinant Mycoplasma pneumoniae Protein P200 (p200) , partial

• CAS Number: 9000-83-3
• Gene Name: p200
• UniProt: P75211
• Expression Region: 857-985aa
• Organism: Mycoplasma pneumoniae (strain ATCC 29342 / M129)
• Target Sequence: LDWELLIGNSNYGHYEPSGEWVWAGYFDDNQIWTPDASVEWARESDYTDLIGDEIYGRYNRKGEWIWYGYYDETGEWVLVDEHYQNHQPRISEAPRFWEQLIGNEDYGYYEDNEWKWYDGEFDSEGNWL
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Source: E.coli
• Field of Research: Epigenetics and Nuclear Signaling
• Assay Type: In Stock Protein
• Relevance: Protein cytoskeleton-associated which plays a role in gliding motility and perhaps also in mucociliary clearance.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Activity: Not Test
• Length: Partial
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 23.2 kDa
• References & Citations: "The P200 protein of Mycoplasma pneumoniae shows common features with the cytadherence-associated proteins HMW1 and HMW3." Proft T., Hilbert H., Plagens H., Herrmann R. Gene 171:79-82 (1996)
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.