Recombinant Human Growth/differentiation factor 7 (GDF7) (Active)

CAT:
399-CSB-AP005961HU-02
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Growth/differentiation factor 7 (GDF7) (Active) - image 1

Recombinant Human Growth/differentiation factor 7 (GDF7) (Active)

  • CAS Number:

    9000-83-3
  • Gene Name:

    GDF7_HUMAN
  • UniProt:

    Q7Z4P5
  • Expression Region:

    322-450aa
  • Organism:

    Homo sapiens
  • Target Sequence:

    TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
  • Tag:

    Tag-Free
  • Source:

    E.Coli
  • Field of Research:

    Signal Transduction
  • Assay Type:

    Active Protein & In Stock Protein
  • Relevance:

    May play an active role in the motor area of the primate neocortex.
  • Endotoxin:

    Less than 0.1 EU/µg as determined by LAL method.
  • Purity:

    >95% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg.
  • Length:

    Full Length of Mature Protein
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 µm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    14.0 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.