Chicken IL-2 Biotinylated Recombinant Protein

CAT:
908-RPB1819C-01
Size:
1 Vial
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Chicken IL-2 Biotinylated Recombinant Protein - image 1

Chicken IL-2 Biotinylated Recombinant Protein

  • Background:

    IL-2 is produced by T-helper cells in response to antigenic or mitogenic stimulation. It is required for T-cell proliferation and other activities crucial to the regulation of the immune response. IL-2 was discovered to be a member of a family of cytokines, which also includes IL-4, IL-7, IL-9, IL-15 and IL-21. IL-2 signals through a receptor complex consisting of IL-2 specific IL-2 receptor alpha (CD25), IL-2 receptor beta (CD122) and a common gamma chain (γc) . All members of this family use the common gamma chain as part of their signaling complex.
  • Description:

    The Chicken IL-2 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-2 Biotinylated applications are for cell culture. Chicken IL-2 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-2 Biotinylated Specifications: (Molecular Weight: 14.0 kDa) (Amino Acid Sequence: ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK) (Gene ID: 373958) . For research use only.
  • Label:

    Biotin
  • Applications:

    Cell Culture
  • Homology:

    Gallus gallus (chicken)
  • Storage Temperature:

    -20°C