Gibbon IFN beta Recombinant Protein

• Background:

  Type I interferons comprise a vast and growing group of IFN proteins. Homologous molecules to type I IFNs are found in many species, including all mammals, and some have been identified in birds, reptiles, amphibians and fish species. The mammalian types are designated IFN-α, IFN-β, IFN-kappa, IFN-delta, IFN-epsilon, IFN-tau, IFN-omega, and IFN-zeta (also known as limitin) . They are mainly involved in innate immune response against viral infection.

• Description:

  The Gibbon IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Gibbon IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. Gibbon IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Gibbon IFN beta Specifications: (Molecular Weight: 20.1 kDa) (Amino Acid Sequence: MSYNLLGFLQRRSSFQCQKLLWQLNGKLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAVFRQDLSSTGWNETIVENLLANVYHQIDHLKTVLEEKLEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTVVRVEILRNFFFINRLTGYLRN (166) ) (Gene ID: 100598986) . For research use only.

• Applications:

  Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

• Homology:

  Nomascus leucogenys (northern white-cheeked gibbon)

• Storage Temperature:

  -20°C