Feline M-CSF Recombinant Protein
CAT:
908-RP1702F-01
Size:
1 Vial
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Feline M-CSF Recombinant Protein
Background:
M-CSF (Macrophage colony-stimulating factor), also known as CSF-1, is a hematopoietic growth factor that is involved in the proliferation, differentiation, and survival of monocytes, macrophages, and bone marrow progenitor cells. M-CSF enhances expression of differentiation antigens and stimulates chemotactic, phagocytic and the killing activities of monocytes. M-CSF also stimulates production of several cytokines, including GM- CSF, G-CSF and IL-6 by priming monocytes. It also stimulates production and secretion of IL-8 and reactive nitrogen intermediates. In addition to the stimulation of hematopoiesis, M-CSF also stimulates differentiation and proliferation of osteoclast progenitor cells and cytotrophoblasts.Description:
The Feline M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Feline M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Feline M-CSF Specifications: (Molecular Weight: 18.4 kDa) (Amino Acid Sequence: EEVSERCSHMIGNGHLQFLQQLIDSQMETSCQIAFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFKDNTPNANVIVTLQELSLRLSSCFTKDYEEQDKACVRTFHETPLQLLEKIKNVFNETKNLLKKDWNVFSKNCNKSFEKCSSQGHDRQQEGP (158) ) (Gene ID: 101091467) . For research use only.Applications:
Cell Culture, ELISA Standard, ELISpot Control, Western Blot ControlHomology:
Felis catus (domestic cat), Lynx canadensis (Canada lynx), Lynx pardinus (Spanish lynx), Puma concolor (puma)Storage Temperature:
-20°C