Bovine CCL11 (Eotaxin-1) Biotinylated Recombinant Protein
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Bovine CCL11 (Eotaxin-1) Biotinylated Recombinant Protein
Background:
CCL11 belongs to the CC chemokine family and is commonly known as Eotaxin-1. There are at least 27 distinct members of the C-C subgroup reported for mammals. CC chemokines induce the migration of monocytes and other cell types such as NK cells and dendritic cells. CCL11 selectively recruits eosinophils by inducing their chemotaxis, and therefore, is implicated in allergic responses. Endothelial cells, smooth muscle cells, epithelial cells, alveolar macrophages and eosinophils are known to produce CCL11.Description:
The Bovine CCL11 (Eotaxin-1) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL11 (Eotaxin-1) Biotinylated applications are for cell culture. Bovine CCL11 (Eotaxin-1) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL11 (Eotaxin-1) Biotinylated Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQKAVIFNTKQNKKICVDPQEKWVQNAMEYLNQKSQTLKS) (Gene ID: 404072) . For research use only.Label:
BiotinApplications:
Cell CultureHomology:
Bison bison bison (American buffalo), Bos indicus (zebu), Bos javanicus (banteng), Bos mutus (wild yak), Bos taurus (cattle), Bubalus bubalis (water buffalo), Bubalus kerabau (carabao)Storage Temperature:
-20°C
