Cynomolgus Monkey CCL8 (MCP-2) Recombinant Protein

CAT:
908-RP1877Y-01
Size:
1 Vial
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Cynomolgus Monkey CCL8 (MCP-2) Recombinant Protein - image 1

Cynomolgus Monkey CCL8 (MCP-2) Recombinant Protein

  • Background:

    CCL8, also known as MCP-2, is a member of the CC chemokine family. There are at least 27 distinct members of the C-C subgroup reported for mammals. CCL8 is chemotactic for and activates many different immune cells, including mast cells, eosinophils and basophils, (that are implicated in allergic responses), and monocytes, T cells, and NK cells that are involved in the inflammatory response.
  • Description:

    The Cynomolgus Monkey CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CCL8 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AQPDSVSIPITCCFNVINRKIPIQRLQSYTRITNTQCPKEAVIFKTKWGKEVCADPKERWVRDSMKHLDQMFQNLKP (77) ) (Gene ID: 102137164) . For research use only.
  • Applications:

    Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control
  • Homology:

    Macaca fascicularis (crab-eating macaque), Macaca mulatta (Rhesus monkey), Macaca nemestrina (pig-tailed macaque)
  • Storage Temperature:

    -20°C