Equine CXCL10 (IP-10) Recombinant Protein

CAT:
908-RP0058E-01
Size:
1 Vial
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Equine CXCL10 (IP-10) Recombinant Protein - image 1

Equine CXCL10 (IP-10) Recombinant Protein

  • Background:

    CXCL10, also known as Interferon gamma-induced protein 10 or small-inducible cytokine B10, is a member of the C-X-C chemokine family. CXCL10 is secreted by several cell types in response to IFN-gamma. These cell types include monocytes, endothelial cells and fibroblasts. CXCL10 has been attributed to several roles, such as chemoattraction for monocytes/macrophages, T cells, NK cells, and dendritic cells, promotion of T cell adhesion to endothelial cells, antitumor activity, and inhibition of bone marrow colony formation and angiogenesis. There have been 17 different C-X-C chemokines described in mammals, that are subdivided into two categories, those with a specific amino acid sequence (or motif) of glutamic acid-leucine-arginine (or ELR for short) immediately before the first cysteine of the C-X-C motif (ELR-positive), and those without an ELR motif (ELR-negative) . ELR-positive C-X-C chemokines specifically induce the migration of neutrophils, and interact with chemokine receptors CXCR1 and CXCR2. C-X-C chemokines that lack the ELR motif are chemoattractant for lymphocytes. CXCL10 elicits its effects by binding to the cell surface chemokine receptor CXCR3.
  • Description:

    The Equine CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CXCL10 Specifications: (Molecular Weight: 9.4 kDa) (Amino Acid Sequence: IPLSRTARCTCINISDRPIPPRSLEKLEMIPASQSCQRVEIIATMKKNGEKRCLNPESKTVKNLLKAISKQRSKRSPRTLREV) . For research use only.
  • Applications:

    Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control
  • Homology:

    Equus caballus (horse), Equus przewalskii (Przewalski's horse)
  • Storage Temperature:

    -20°C