Feline IL-1 beta Recombinant Protein

• Background:

  IL-1 beta is produced by activated macrophages, monocytes, and a subset of dentritic cells. This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The IL-1 family of cytokines encompasses eleven proteins that each share a similar β-barrel structure and bind to Ig-like receptors. Several of the well characterized members of the IL-1-like cytokines play key roles in the development and regulation of inflammation. IL-1α, IL-1β, and IL-18 (IL-1F4) are well-known inflammatory cytokines active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. In contrast, IL-1 receptor antagonist (IL-1ra; IL-1F3) and IL-36 receptor antagonist (IL-36ra; IL-1F5) reduce inflammation by blocking the binding of the agonist receptor ligands. IL-33 (IL-1F11) is thought to function as an 'alarmin' released following cell necrosis to alerting the immune system to tissue damage or stress. The biological properties of IL-37 (IL-1F7) are mainly those of down-regulating inflammation.

• Description:

  The Feline IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Feline IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-1 beta Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: AAIQSQDYTFRDISQKSLVLSGSYELRALHLNGQNMNQQVVFRMSFVHGEENSKKIPVVLCIKKNNLYLSCVMKDGKPTLQLEMLDPKVYPKKKMEKRFVFNKTEIKGNVEFESSQFPNWYISTSQAEEMPVFLGNTKGGQDITDFIMESAS) (Gene ID: 768274) . For research use only.

• Applications:

  Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

• Homology:

  Acinonyx jubatus (cheetah), Felis catus (domestic cat), Leopardus geoffroyi (Geoffroy's cat), Lynx canadensis (Canada lynx), Lynx pardinus (Spanish lynx), Lynx rufus (bobcat), Panthera uncia (snow leopard), Prionailurus bengalensis (leopard cat), Prionailurus viverrinus (fishing cat)

• Storage Temperature:

  -20°C