Recombinant Mouse High affinity copper uptake protein 1 (Slc31a1), partial

• Product Name Alternative:

  Copper transporter 1; Solute carrier family 31 member 1

• Abbreviation:

  Recombinant Mouse Slc31a1 protein, partial

• Gene Name:

  Slc31a1

• UniProt:

  Q8K211

• Expression Region:

  1-74aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  MNHMGMNHMEMHHHMGMNHTDDNITMPPHHHPTTSASHSHGGGDSMMMMPMTFYFDFKNVNLLFSGLVINTPGE

• Tag:

  C-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Neuroscience

• Relevance:

  Uniporter that mediates the transport of copper (1+) from the extracellular space to the cytoplasm, across the plasma membrane. Then, delivers directly copper (1+) to specific chaperone such as ATOX1, via a copper (1+) - mediated transient interaction between the C-terminal domain and a copper (1+) chaperone, thus controlling intracellular copper (1+) levels. May function in copper (1+) import from the apical membrane thus may drive intestinal copper absorption. The copper (1+) transport mechanism is sodium-independent, saturable and of high-affinity. Also mediates the uptake of silver (1+) . May function in the influx of the platinum-containing chemotherapeutic agents. The platinum-containing chemotherapeutic agents uptake is saturable. Also participates in the first step of copper (2+) acquisition by cells through a direct transfer of copper (2+) from copper (2+) carriers in blood, such as ALB to the N-terminal domain of SLC31A1, leading to copper (2+) reduction and probably followed by copper (1+) stabilization. In addition, functions as a redox sensor to promote angiogenesis in endothelial cells, in a copper (1+) transport independent manner, by transmitting the VEGF-induced ROS signal through a sulfenylation at Cys-195 leading to a subsequent disulfide bond formation between SLC31A1 and KDR. The SLC31A1-KDR complex is then co-internalized to early endosomes, driving a sustained VEGFR2 signaling

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  15.3 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial of BC004372