Recombinant Human/Cynomolgus monkey Activin receptor type-2A (ACVR2A), partial (Active)

• Product Name Alternative:

  Activin receptor type-2A; EC:2.7.11.30; Activin receptor type IIA (ACTR-IIA; ACTRIIA) ; ACVR2A; ACVR2

• Abbreviation:

  Recombinant Human/Cynomolgus monkey ACVR2A protein, partial (Active)

• Gene Name:

  ACVR2A

• UniProt:

  P27037/A0A7N9IF81

• Expression Region:

  20-135aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP

• Tag:

  C-terminal hFc1-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Signal Transduction

• Relevance:

  On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin A, activin B and inhibin A. Mediates induction of adipogenesis by GDF6.

• Endotoxin:

  Less than 1.0 EU/ug as determined by LAL method.

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Measured by its binding ability in a functional ELISA.Immobilized Human INHBA (CSB-MP011719HU1b0) at 2 μg/mL can bind Human ACVR2A.The EC50 is 74.75-84.73 ng/mL.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  42.3 kDa

• References & Citations:

  Activin a Receptor Type 2A Mutation Affects the Tumor Biology of Microsatellite Instability-High Gastric Cancer. Yuza K., Nagahashi M., Ichikawa H., Hanyu T., Nakajima M., Shimada Y., Ishikawa T., Sakata J., Takeuchi S., Wakai T. J Gastrointest Surg 25:2231-2241 (2021)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial