Recombinant Human ATP synthase subunit f, mitochondrial (ATP5J2)

CAT:
399-CSB-CF002370HU (A4)-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human ATP synthase subunit f, mitochondrial (ATP5J2) - image 1

Recombinant Human ATP synthase subunit f, mitochondrial (ATP5J2)

  • Product Name Alternative:

    (ATP synthase membrane subunit f)
  • Abbreviation:

    Recombinant Human ATP5MF protein
  • Gene Name:

    ATP5MF
  • UniProt:

    P56134
  • Expression Region:

    1-94aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH
  • Tag:

    N-terminal 10xHis-tagged
  • Type:

    CF Transmembrane Protein & In Stock Protein
  • Source:

    In vitro E.coli expression system
  • Field of Research:

    Others
  • Relevance:

    Mitochondrial membrane ATP synthase (F (1) F (0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F (1) - containing the extramembraneous catalytic core and F (0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F (1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F (0) domain. Minor subunit located with subunit a in the membrane.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    12.4 kDa
  • References & Citations:

    "Dimer ribbons of ATP synthase shape the inner mitochondrial membrane." Strauss M., Hofhaus G., Schroder R.R., Kuhlbrandt W. EMBO J 27:1154-1160 (2008)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length