Recombinant Hordeum vulgare Nucleotide pyrophosphatase/phosphodiesterase (npp)

• Gene Name:

  npp

• UniProt:

  Q687E1

• Expression Region:

  1-368aa

• Organism:

  Hordeum vulgare (Barley)

• Target Sequence:

  AAVRASPDLLGSRGEDTASDGSVVWAKPYTFRAPPTPGQNSLQRIIVFGDMGKAERDGSNEFANYQPGSLNTTDRLIEDLDNYDIVFHIGDMPYANGYLSQWDQFTAQVAPISAKKPYMVASGNHERDWPNTGGFFDVKDSGGECGVPAETMYYYPAENRANFWYKVDYGMFRFCVGDSEHDWREGTPQYKFIEECLSTVDRKHQPWLIFTAHRVLGYSSNSWYADQGSFEEPEGRESLQKLWQRYRVDIAYFGHVHNYERTCPLYQSQCVNADKTHYSGTMNGTIFVVAGGGGSHLSSYTTAIPKWSIFRDHDYGFTKLTAFNHSSLLFEYMKSSDGKVYDSFTIHRDYRDVLSCVHDSCFPTTLAS

• Tag:

  N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Source:

  E.coli

• Field of Research:

  Others

• Assay Type:

  In Stock Protein

• Relevance:

  Hydrolyzes pyrophosphate, phosphodiester and phosphosulfate linkages of nucleotide-sugars, sulfonucleotides and nucleoside di and triphosphates. Highest activity observed with the substrates ADP-glucose and adenosine 5'-phosphosulfate.

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Length:

  Full Length

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  49.2 kDa

• References & Citations:

  "Cloning, expression and characterization of a glycosylated nucleotide pyrophosphatase/phosphodiesterase occurring in chloroplasts that belongs to a widely distributed group of plant nucleotide hydrolases." Nanjo Y., Rodriguez-Lopez M., Munoz F.J., Kurokawa S., Baroja-Fernandez E., Mitsui T., Pozueta-Romero J. Submitted (AUG-2003)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

• CAS Number:

  9000-83-3