Recombinant Mouse 40S ribosomal protein S3 (RPS3)

• Product Name Alternative:

  40S ribosomal protein S3 (EC 4.2.99.18)

• Abbreviation:

  Recombinant Mouse RPS3 protein

• Gene Name:

  RPS3

• UniProt:

  P62908

• Expression Region:

  2-243aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  AVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPSGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA

• Tag:

  N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Cell Biology

• Relevance:

  Involved in translation as a component of the 40S small ribosomal subunit (By similarity) . Has endonuclease activity and plays a role in repair of damaged DNA (PubMed:7775413) . Cleaves phosphodiester bonds of DNAs containing altered bases with broad specificity and cleaves supercoiled DNA more efficiently than relaxed DNA (By similarity) . Displays high binding affinity for 7,8-dihydro-8-oxoguanine (8-oxoG), a common DNA lesion caused by reactive oxygen species (ROS) (By similarity) . Has also been shown to bind with similar affinity to intact and damaged DNA (By similarity) . Stimulates the N-glycosylase activity of the base excision protein OGG1 (By similarity) . Enhances the uracil excision activity of UNG1 (By similarity) . Also stimulates the cleavage of the phosphodiester backbone by APEX1 (By similarity) . When located in the mitochondrion, reduces cellular ROS levels and mitochondrial DNA damage (By similarity) . Has also been shown to negatively regulate DNA repair in cells exposed to hydrogen peroxide (By similarity) . Plays a role in regulating transcription as part of the NF-kappa-B p65-p50 complex where it binds to the RELA/p65 subunit, enhances binding of the complex to DNA and promotes transcription of target genes (By similarity) . Represses its own translation by binding to its cognate mRNA (By similarity) . Binds to and protects TP53/p53 from MDM2-mediated ubiquitination (By similarity) . Involved in spindle formation and chromosome movement during mitosis by regulating microtubule polymerization (By similarity) . Involved in induction of apoptosis through its role in activation of CASP8 (PubMed:14988002) . Induces neuronal apoptosis by interacting with the E2F1 transcription factor and acting synergistically with it to up-regulate pro-apoptotic proteins BCL2L11/BIM and HRK/Dp5 (By similarity) . Interacts with TRADD following exposure to UV radiation and induces apoptosis by caspase-dependent JNK activation (By similarity) .

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  34.0 kDa

• References & Citations:

  "RpS3, a DNA repair endonuclease and ribosomal protein, is involved in apoptosis." Jang C.Y., Lee J.Y., Kim J. FEBS Lett. 560:81-85 (2004)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein