IGF-1

• Description :

  IGF-1 is a small protein secreted mainly but not solely by the liver and circulating in blood mostly as a complex with various IGF binding proteins in the blood. It has growth-regulating, insulin-like, and mitogenic activities and it is secreted in response to growth hormone stimulation. Recombinant rabbit IGF-I produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 71 amino acids and having a molecular mass of 7639 Dalton.

• Synonyms :

  Igf1; Igf-1; Igf-I; C730016P09Rik

• NCBI Gene ID :

  100008668

• UniProt :

  Q95222

• Accession Number :

  NP_001075495.1

• Accession Number mRNA :

  NM_001082026.1

• Reactivity :

  Rabbit

• Cross Reactivity :

  Rabbit

• Sequence :

  MTGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKAA

• Assay Protocol :

  It is recommended to reconstitute the lyophilized rbIGF-I in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

• Endotoxin :

  < 0.1 ng/µg of protein (< 1EU/µg)

• Purity :

  > 98.0% as determined by Gel filtration and SDS-PAGE gel.

• Bioactivity :

  RbIGF-I is biologically active when compared to human IGF-1. The ED50, calculated by the dose -dependent proliferation of human MCF/7 cells is 5 to 25 ng/ml in the cell culture mixture dependent on culture conditions. Its activity consisits of 30-40 % compared to human IGF-1.

• Length :

  72

• Form :

  Lyophilized

• Reconstitution :

  0.4% NaHCO3

• Molecular Weight :

  7.6 kDa

• Host or Source :

  E. coli