Recombinant Protobothrops flavoviridis Thrombin-like enzyme flavoxobin (TLF1)

CAT:
399-CSB-EP356569EZB-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Protobothrops flavoviridis Thrombin-like enzyme flavoxobin (TLF1) - image 1

Recombinant Protobothrops flavoviridis Thrombin-like enzyme flavoxobin (TLF1)

  • Gene Name:

    TLF1
  • UniProt:

    P05620
  • Expression Region:

    25-260aa
  • Organism:

    Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis)
  • Target Sequence:

    VIGGDECNINEHPFLVALYDAWSGRFLCGGTLINPEWVLTAAHCDSKNFKMKLGAHSKKVLNEDEQIRNPKEKFICPNKKNDEVLDKDIMLIKLDSPVSYSEHIAPLSLPSSPPSVGSVCRIMGWGSITPVEETFPDVPHCANINLLDDVECKPGYPELLPEYRTLCAGVLQGGIDTCGFDSGTPLICNGQFQGIVSYGGHPCGQSRKPGIYTKVFDYNAWIQSIIAGNTAATCLP
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Source:

    E.coli
  • Field of Research:

    Others
  • Assay Type:

    In Stock Protein
  • Relevance:

    Thrombin-like snake venom serine protease that clots fibrinogen by releasing fibrinopeptide A. According to PubMed:8585090, only cleaves rabbit fibrinogen, whereas no specificity is described in PubMed:3910643. Also acts as a C3 convertase that independently cleaves human C3 and kick-starts the complement cascade. Also increases urokinase-type plasminogen activator and plasminogen activator inhibitor in cultured bovine pulmonary artery endothelial cells. Dose-dependently inhibits collagen-induced platelet aggregation.
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Length:

    Full Length of Mature Protein
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    33.1 kDa
  • References & Citations:

    "Habutobin releases plasminogen activator (U-PA) from bovine pulmonary artery endothelial cells." Sunagawa M., Hanashiro K., Nakamura M., Kosugi T. Toxicon 34:691-699 (1996)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • CAS Number:

    9000-83-3