AURKC Rabbit pAb (APR29761N)
CAT:
882-APR29761N-01
Size:
50 µL
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


AURKC Rabbit pAb (APR29761N)
Background:
This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules in relation to centrosome/spindle function during mitosis. This gene is overexpressed in several cancer cell lines, suggesting an involvement in oncogenic signal transduction. Alternative splicing results in multiple transcript variants.Synonyms:
AURKC; AIE2; AIK3; ARK3; AurC; HEL-S-90; SPGF5; STK13; aurora-CGene ID:
6795UniProt:
Q9UQB9Cellular Locus:
Chromosome, Cytoplasm, Nucleus, centromere, cytoskeleton, spindleDilution:
WB 1:500 - 1:2000Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 32kDa/33kDa/35kDa Observed MW: 36KDaStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality AURKC Rabbit pAb (APR23451N7) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6795Uniprot URL:
https://www.uniprot.org/uniprot/Q9UQB9AA Sequence:
MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQH