[KO Validated] ADIPOR1 Rabbit pAb (APR29585N)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
![[KO Validated] ADIPOR1 Rabbit pAb (APR29585N) - image 1](/gentaur-product-1.webp)
![[KO Validated] ADIPOR1 Rabbit pAb (APR29585N) - image 1](/gentaur-product-1.webp)
[KO Validated] ADIPOR1 Rabbit pAb (APR29585N)
Background:
This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene.Synonyms:
ADIPOR1; ACDCR1; CGI-45; CGI45; PAQR1; TESBP1AGene ID:
51094UniProt:
Q96A54Cellular Locus:
Cell membrane, Multi-pass membrane proteinDilution:
WB 1:500 - 1:2000Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 42kDa Observed MW: 43kDaStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] ADIPOR1 Rabbit pAb (APR24174N5) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51094Uniprot URL:
https://www.uniprot.org/uniprot/Q96A54AA Sequence:
MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETG
