Β-Tubulin Rabbit pAb (APR28872N)

CAT:
882-APR28872N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Β-Tubulin Rabbit pAb (APR28872N) - image 1

Β-Tubulin Rabbit pAb (APR28872N)

  • Background:

    This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13.
  • Synonyms:

    CDCBM6; CSCSC1; M40; OK/SW-cl.56; TUBB1; TUBB5; Beta Tubulin; TUBB; β-Tubulin
  • Gene ID:

    203068
  • UniProt:

    P07437
  • Cellular Locus:

    Cytoplasm, cytoskeleton
  • Applications:

    WB (Mus musculus, Homo sapiens, Rattus norvegicus, Crassostrea gigas, Oncorhynchus mykiss, Brachyura) IF (Mus musculus, Rattus norvegicus, Homo sapiens) IHC (Rattus norvegicus)
  • Dilution:

    WB 1:500 - 1:5000 IHC 1:50 - 1:200 IF 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 50kDa Observed MW: 50kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality β-Tubulin Rabbit pAb (APR28872N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=203068
  • Uniprot URL:

    https://www.uniprot.org/uniprot/P07437
  • AA Sequence:

    SDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPF