UBE2Q2 Rabbit pAb (APR28831N)

• Background:

  Ube2Q2 is an E2 enzyme, which is part of the E1, E2, and E3 cascade responsible for ubiquitination of protein substrates. Ube2Q2 is thought to play a key role in regulating mitotic stages in cells. Its discovery was in connection with an arrest in the mitotic cell cycle. Inactivating this E2 prohibits the cell from continuing on past prophase. In cases of head and neck squamou cell carcinaoma, there is an elevated level of Ube2Q2 in the cancerous tissues. Also when the expression levels decreased, the cancerous cells were found to have a resistance to chemotherapeutic agents.

• Synonyms:

  UBE2Q2

• Gene ID:

  92912

• UniProt:

  Q8WVN8

• Cellular Locus:

  Cytoplasm

• Applications:

  WB (Homo sapiens)

• Dilution:

  WB 1:500 - 1:2000 IF 1:50 - 1:100

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 36kDa/38kDa/40kDa/42kDa Observed MW: 43kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality UBE2Q2 Rabbit pAb (APR28831N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=92912

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q8WVN8

• AA Sequence:

  MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEEEEEEEEMAED