EIF3L Rabbit pAb (APR28811N)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


EIF3L Rabbit pAb (APR28811N)
Background :
Component of the eukaryotic translation initiation factor 3 (eIF-3 complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC. The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression.Synonyms :
EIF3L; EIF3EIP; EIF3S11; EIF3S6IP; HSPC021; HSPC025; MSTP005Gene ID :
51386UniProt :
Q9Y262Cellular Locus :
CytoplasmDilution :
WB 1:1000 - 1:4000 IHC 1:50 - 1:200Form :
LiquidBuffer :
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight :
Calculated MW: 61kDa/66kDa Observed MW: 67kDaStorage Conditions :
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview :
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EIF3L Rabbit pAb (APR28811N) .Gene ID URL :
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51386Uniprot URL :
https://www.uniprot.org/uniprot/Q9Y262AA Sequence :
MSYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPSLEQRFESYYNYCNLFNYILNADGPAPLELPNQWLWDIIDEFIYQFQSFSQYRCKTAKKSEEEIDFLRSNPKIWNVHSVLNV

