MT-CYB Rabbit pAb (APR28659N)

• Background:

  Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex that is part of the mitochondrial respiratory chain. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c. Contributes to the generation of a proton gradient across the mitochondrial membrane that is then used for ATP synthesis.

• Synonyms:

  MT-CYB; MTCYB; CYTB; Mt-Cyb

• Gene ID:

  17711

• UniProt:

  P00158

• Cellular Locus:

  Mitochondrion inner membrane, Multi-pass membrane protein

• Applications:

  WB (Mouse heart, Danio rerio, Mus musculus, Homo sapiens, Sus scrofa)

• Dilution:

  WB 1:200 - 1:1000

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 43kDa Observed MW: 43kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MT-CYB Rabbit pAb (APR28659N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=17711

• Uniprot URL:

  https://www.uniprot.org/uniprot/P00158

• AA Sequence:

  MTNMRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQIITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGR