TIMM10B Rabbit pAb (APR28274N)

• Synonyms:

  TIMM10B; FXC1; TIM10B; Tim9b

• Gene ID:

  26515

• UniProt:

  Q9Y5J6

• Cellular Locus:

  Mitochondrion inner membrane, Peripheral membrane protein

• Dilution:

  WB 1:500 - 1:2000 IHC 1:50 - 1:100

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 11kDa Observed MW: 24kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TIMM10B Rabbit pAb (APR28274N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26515

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q9Y5J6

• AA Sequence:

  MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS