RSAD2 Rabbit pAb (APR28079N)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


RSAD2 Rabbit pAb (APR28079N)
Background:
Interferon-inducible antiviral protein which plays a major role in the cell antiviral state induced by type I and type II interferon. Catalyzes the conversion of cytidine triphosphate (CTP to 3'-deoxy-3',4'-didehydro-CTP (ddhCTP via a SAM-dependent radical mechanism. In turn, ddhCTP acts as a chain terminator for the RNA-dependent RNA polymerases from multiple viruses and directly inhibits viral replication. Therefore, inhibits a wide range of DNA and RNA viruses, including human cytomegalovirus (HCMV, hepatitis C virus (HCV, west Nile virus (WNV, dengue virus, sindbis virus, influenza A virus, sendai virus, vesicular stomatitis virus (VSV, zika virus, and human immunodeficiency virus (HIV-1. Promotes also TLR7 and TLR9-dependent production of IFN-beta production in plasmacytoid dendritic cells (pDCs by facilitating 'Lys-63'-linked ubiquitination of IRAK1 by TRAF6. Plays a role in CD4+ T-cells activation and differentiation. Facilitates T-cell receptor (TCR-mediated GATA3 activation and optimal T-helper 2 (Th2 cytokine production by modulating NFKB1 and JUNB activities. Can inhibit secretion of soluble proteins.Synonyms:
RSAD2; 2510004L01Rik; cig33; cig5; vig1Gene ID:
91543UniProt:
Q8WXG1Cellular Locus:
Cytoplasmic side, Endoplasmic reticulum, Endoplasmic reticulum membrane, Golgi apparatus, Lipid droplet, Mitochondrion, Mitochondrion inner membrane, Mitochondrion outer membrane, Peripheral membrane proteinDilution:
WB 1:500 - 1:2000 IF 1:50 - 1:200Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 42kDa Observed MW: 46KDaStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RSAD2 Rabbit pAb (APR28079N) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=91543Uniprot URL:
https://www.uniprot.org/uniprot/Q8WXG1AA Sequence:
LATKRRKQQLVLRGPDETKEEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW
