ATP6 Rabbit pAb (APR28027N)

• Background:

  Mitochondrial membrane ATP synthase (F (1F (0 ATP synthase or Complex V produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F (1 - containing the extramembraneous catalytic core and F (0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F (1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

• Synonyms:

  MT-ATP6; ATPase6; MTATP6; ATP6

• Gene ID:

  17705

• UniProt:

  P00848

• Cellular Locus:

  Mitochondrion inner membrane, Multi-pass membrane protein

• Applications:

  WB (Mus musculus, Homo sapiens, Sus scrofa, Rattus norvegicus)

• Dilution:

  WB 1:500 - 1:2000 IHC 1:100 - 1:200 IF 1:50 - 1:200

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 25kDa Observed MW: 20kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ATP6 Rabbit pAb (APR28027N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=17705

• Uniprot URL:

  https://www.uniprot.org/uniprot/P00848

• AA Sequence:

  MNLSMAIPLWAGAVITGFRHKLKSSLAHFLPQGTPISLIPMLIIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLVLMNISPPTATITFIILLLLTILEFAVALIQAYVFTLLVSLYLHDNT