STAT5A Rabbit pAb (APR27648N)

CAT:
882-APR27648N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
STAT5A Rabbit pAb (APR27648N) - image 1

STAT5A Rabbit pAb (APR27648N)

  • Background:

    The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated by, and mediates the responses of many cell ligands, such as IL2, IL3, IL7 GM-CSF, erythropoietin, thrombopoietin, and different growth hormones. Activation of this protein in myeloma and lymphoma associated with a TEL/JAK2 gene fusion is independent of cell stimulus and has been shown to be essential for tumorigenesis. The mouse counterpart of this gene is found to induce the expression of BCL2L1/BCL-X (L), which suggests the antiapoptotic function of this gene in cells. Alternatively spliced transcript variants have been found for this gene.
  • Synonyms:

    MGF; STAT5; STAT5A
  • Gene ID:

    6776
  • UniProt:

    P42229
  • Cellular Locus:

    Cytoplasm, Nucleus
  • Applications:

    WB (U937, Homo sapiens, Mus musculus, Rattus norvegicus)
  • Dilution:

    WB 1:500 - 1:2000 IF 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 86kDa/90kDa Observed MW: 90kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality STAT5A Rabbit pAb (APR27648N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6776
  • Uniprot URL:

    https://www.uniprot.org/uniprot/P42229
  • AA Sequence:

    SPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS