CAMK1G Rabbit pAb (APR27343N)

CAT:
882-APR27343N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
CAMK1G Rabbit pAb (APR27343N) - image 1

CAMK1G Rabbit pAb (APR27343N)

  • Background:

    This gene encodes a protein similar to calcium/calmodulin dependent protein kinase, however, its exact function is not known.
  • Synonyms:

    CAMK1G; CLICK3; CLICKIII; VWS1; dJ272L16.1
  • Gene ID:

    57172
  • UniProt:

    Q96NX5
  • Cellular Locus:

    Cell membrane, Cytoplasm, Golgi apparatus membrane, Peripheral membrane protein
  • Dilution:

    WB 1:500 - 1:2000 IHC 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 51kDa/53kDa Observed MW: 53kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CAMK1G Rabbit pAb (APR27343N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57172
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q96NX5
  • AA Sequence:

    PPFYEETESKLFEKIKEGYYEFESPFWDDISESAKDFICHLLEKDPNERYTCEKALSHPWIDGNTALHRDIYPSVSLQIQKNFAKSKWRQAFNAAAVVHHMRKLHMNLHSPGVRPEVENRPPETQASETSRPSSPEITITEAPVLDHSVALPALTQLPCQHGRRPTAPGGRSLNCLVNGSLHISSSLVPMHQGSLAAGPCGCCSSCLNIGSKGKSSYCSEPTLLKKANKKQNFKSEVMVPVKASGSSHCRAGQTGVCLIM