SAT2 Rabbit pAb (APR27205N)

CAT:
882-APR27205N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
SAT2 Rabbit pAb (APR27205N) - image 1

SAT2 Rabbit pAb (APR27205N)

  • Background:

    Catalyzes the N-acetylation of the amino acid thialysine (S- (2-aminoethyl-L-cysteine, a L-lysine analog with the 4-methylene group substituted with a sulfur. May also catalyze acetylation of polyamines, such as norspermidine, spermidine or spermine. However, ability to acetylate polyamines is weak, suggesting that it does not act as a diamine acetyltransferase in vivo.
  • Synonyms:

    SAT2; SSAT2
  • Gene ID:

    112483
  • UniProt:

    Q96F10
  • Cellular Locus:

    Cytoplasm
  • Dilution:

    WB 1:500 - 1:2000 IF 1:50 - 1:100
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 19kDa Observed MW: 19KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SAT2 Rabbit pAb (APR27205N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=112483
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q96F10
  • AA Sequence:

    MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAGK