SLC23A2 Rabbit pAb (APR26804N)

CAT:
882-APR26804N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
SLC23A2 Rabbit pAb (APR26804N) - image 1

SLC23A2 Rabbit pAb (APR26804N)

  • Background:

    The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1.
  • Synonyms:

    SLC23A2; NBTL1; SLC23A1; SVCT2; YSPL2; hSVCT2
  • Gene ID:

    9962
  • UniProt:

    Q9UGH3
  • Cellular Locus:

    Cell membrane, Multi-pass membrane protein
  • Dilution:

    WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:10 - 1:100
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 58kDa/70kDa Observed MW: 70kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC23A2 Rabbit pAb (APR26804N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9962
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q9UGH3
  • AA Sequence:

    MMGIGKNTTSKSMEAGSSTEGKYEDEAKHPAFFTLPVVINGGATSSGEQDNEDTELMAIYTTENGIAEKSSLAETLDSTGSLDPQRSDMI