[KO Validated] SMARCC1/BAF155 Rabbit pAb (APR26285N)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
![[KO Validated] SMARCC1/BAF155 Rabbit pAb (APR26285N) - image 1](/gentaur-product-1.webp)
![[KO Validated] SMARCC1/BAF155 Rabbit pAb (APR26285N) - image 1](/gentaur-product-1.webp)
[KO Validated] SMARCC1/BAF155 Rabbit pAb (APR26285N)
Background:
The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and contains a predicted leucine zipper motif typical of many transcription factors.Synonyms:
SMARCC1; BAF155; CRACC1; Rsc8; SRG3; SWI3Gene ID:
6599UniProt:
Q92922Cellular Locus:
NucleusDilution:
WB 1:500 - 1:2000 IHC 1:50 - 1:200 IP 1:50 - 1:200Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 122kDa Observed MW: 155KDaStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] SMARCC1/BAF155 Rabbit pAb (APR26285N) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6599Uniprot URL:
https://www.uniprot.org/uniprot/Q92922AA Sequence:
LVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGALCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYSSSQDDEEWLRPVMRKEKQVLVHWGFYPDSYDTWVHSNDVDAEIEDPPIPEKPWKVHVKWILDTDIFNEWMNEEDYEVDENRKPVSFRQRISTKNEEPVRSPERRDRKASA
