PP2A-Aα/PR65α/PPP2R1A Rabbit pAb (APR26112N)

CAT:
882-APR26112N-02
Size:
100 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PP2A-Aα/PR65α/PPP2R1A Rabbit pAb (APR26112N) - image 1

PP2A-Aα/PR65α/PPP2R1A Rabbit pAb (APR26112N)

  • Background:

    This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. This gene encodes an alpha isoform of the constant regulatory subunit A. Alternatively spliced transcript variants have been described.
  • Synonyms:

    PPP2R1A; MRD36; PP2A-Aalpha; PP2AA; PP2AAALPHA; PR65A
  • Gene ID:

    5518
  • UniProt:

    P30153
  • Cellular Locus:

    Chromosome, Cytoplasm, centromere
  • Applications:

    WB (Sus scrofa)
  • Dilution:

    WB 1:500 - 1:2000 IF 1:10 - 1:100
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 65kDa Observed MW: 65KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PP2A-Aα/PR65α/PPP2R1A Rabbit pAb (APR26112N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5518
  • Uniprot URL:

    https://www.uniprot.org/uniprot/P30153
  • AA Sequence:

    MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTEL