EIF3e Rabbit pAb (APR25837N)

CAT: 0882-APR25837N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR25837N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

Component of the eukaryotic translation initiation factor 3 (eIF-3 complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC. The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression. Required for nonsense-mediated mRNA decay (NMD; may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. May interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality eIF3e Rabbit pAb (APR25837N) .

Synonyms

EIF3E; EIF3-P48; EIF3S6; INT6; eIF3-p46

Gene ID

3646

UniProt

P60228

Cellular Locus

Cytoplasm, Nucleus, PML body

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 52kDa Observed MW: 52kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3646

Uniprot URL

https://www.uniprot.org/uniprot/P60228

AA Sequence

MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY

Related Products

Catalog	Name
AMR11925N-01	EIF3e Rabbit mAb (AMR11925N)
APR25897N-01	CBX4 Rabbit pAb (APR25897N)
APR25437N-01	DNALI1 Rabbit pAb (APR25437N)
APR25937N-01	ZEB1 Rabbit pAb (APR25937N)
APR25887N-01	CTSA Rabbit pAb (APR25887N)
APR25836N-01	CBR1 Rabbit pAb (APR25836N)
APR25833N-01	MERTK Rabbit pAb (APR25833N)
APR25817N-01	STXBP1 Rabbit pAb (APR25817N)
APR25537N-01	ERP44 Rabbit pAb (APR25537N)
APR25387N-01	UBL3 Rabbit pAb (APR25387N)

Alternative Products

Catalog	Name
APA4671-01	EIF3e Rabbit pAb
RDSA66042	EIF3e Rabbit mAb
GTR18217932-01	Rabbit eIF3E Antibody
NBP3-30440	Rabbit Polyclonal eIF3e Antibody
AP01470PU-N	EIF3E Rabbit Polyclonal Antibody
abx141750-01	EIF3E (eIF3E) Antibody
MBS8564300-01	EIF3E

EIF3e Rabbit pAb (APR25837N)

Related Products

Alternative Products

Popular Products