JunB Rabbit pAb (APR25699N)

• Background:

  JunB is one of the components of the Activator Protein-1 (AP-1) transcription complex that have been implicated in the control ofthe G0/G1 transtion in fibroblasts. AP-1 is a collection of dimers formed by members of the Jun-, Fos-, ATF- and Maf multigene families that bind to specific DNA regulatory elements called AP-1/12-O-tetradecanoylphorbol-13-acetate-responsive elements (TREs) and cAMP-responsive elements (CREs) . JunB binds to the DNA sequence 5'-TGA[CG]TCA-3', and involves in the regulation of gene activity following the primary growth factor response. It also acts either as a tumor suppressor or as an oncogene depending on the cell and physiopathological context

• Synonyms:

  JUNB; AP-1

• Gene ID:

  3726

• UniProt:

  P17275

• Cellular Locus:

  Nucleus

• Applications:

  WB (Homo sapiens, Mus musculus, Rattus norvegicus)

• Dilution:

  WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 35kDa Observed MW: 43KDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality JunB Rabbit pAb (APR25699N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3726

• Uniprot URL:

  https://www.uniprot.org/uniprot/P17275

• AA Sequence:

  MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFK