SIRPG Rabbit pAb (APR25607N)

• Background:

  The protein encoded by this gene is a member of the signal-regulatory protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. Alternatively spliced transcript variants encoding different isoforms have been described.

• Synonyms:

  SIRPG; CD172g; SIRP-B2; SIRPB2; SIRPgamma; bA77C3.1

• Gene ID:

  55423

• UniProt:

  Q9P1W8

• Cellular Locus:

  Membrane, Single-pass type I membrane protein

• Dilution:

  WB 1:200 - 1:2000

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 18kDa/29kDa/38kDa/42kDa Observed MW: 45-50kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SIRPG Rabbit pAb (APR25607N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55423

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q9P1W8

• AA Sequence:

  IQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEM