LAMP1 Rabbit pAb (APR24865N)

• Background:

  The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis.

• Synonyms:

  LAMP1; CD107a; LAMPA; LGP120

• Gene ID:

  3916

• UniProt:

  P11279

• Cellular Locus:

  Cell membrane, Endosome membrane, Late endosome, Lysosome membrane, Single-pass type I membrane protein

• Applications:

  WB (HEK293T, Mus musculus, Homo sapiens, Rattus norvegicus) IHC (Mus musculus) IF (Homo sapiens, Rattus norvegicus)

• Dilution:

  WB 1:500 - 1:2000 IF 1:50 - 1:200

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 38kDa/44kDa Observed MW: 90-120kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LAMP1 Rabbit pAb (APR24865N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3916

• Uniprot URL:

  https://www.uniprot.org/uniprot/P11279

• AA Sequence:

  CGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHS