[KO Validated] HMGB1 Rabbit pAb (APR24837N)

• Background:

  This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.

• Synonyms:

  HMG-1; HMG1; HMG3; SBP-1; HMGB1

• Gene ID:

  3146

• UniProt:

  P09429

• Cellular Locus:

  Cell membrane, Chromosome, Cytoplasm, Endoplasmic reticulum-Golgi intermediate compartment, Endosome, Extracellular side, Nucleus, Peripheral membrane protein, Secreted

• Applications:

  WB (Mouse brain, Mouse spinal cord, Homo sapiens, Mus musculus) IHC (HeLa, Rattus norvegicus, Mus musculus) IF (Homo sapiens, Mus musculus, Radula lindenbergiana Gott. ex Hartm) IP (Mus musculus)

• Dilution:

  WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 24kDa Observed MW: 29KDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] HMGB1 Rabbit pAb (APR24837N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3146

• Uniprot URL:

  https://www.uniprot.org/uniprot/P09429

• AA Sequence:

  SAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEE