Histone H3 Rabbit pAb (APR24762N)

CAT:
882-APR24762N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Histone H3 Rabbit pAb (APR24762N) - image 1

Histone H3 Rabbit pAb (APR24762N)

  • Background:

    Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4) . The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.
  • Synonyms:

    H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A
  • Gene ID:

    8290
  • UniProt:

    Q16695
  • Cellular Locus:

    Chromosome, Nucleus
  • Applications:

    WB (Mouse embryonic fibroblasts, Raw264.7, Rat brain, HNSCs, Arabidopsis thaliana, Homo sapiens, Mus musculus, Plasmodium falciparum, Rattus norvegicus, Oryza sativa, Gallus gallus, Danio rerio, Bombyx mori Linnaeus, Saccharomyces cerevisiae) IF (Mouse E16.5 neocortex, Homo sapiens)
  • Dilution:

    WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200 ChIP 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 15kDa Observed MW: 17KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Histone H3 Rabbit pAb (APR24762N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8290
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q16695
  • AA Sequence:

    REIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA